RAPSN antibody (N-Term)

Catalog No. ABIN631223

The Rabbit Polyclonal anti-RAPSN antibody has been validated for WB. It is suitable to detect RAPSN in samples from Human, Mouse, Rat and Dog.

Quick Overview for RAPSN antibody (N-Term) (ABIN631223)

Target: RAPSN (Receptor-Associated Protein of The Synapse (RAPSN))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAPSN antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RAPSN Antibody

Binding Specificity: N-Term

Specificity: RAPSN antibody was raised against the N terminal of RAPSN

Purification: Affinity purified

Immunogen: RAPSN antibody was raised using the N terminal of RAPSN corresponding to a region with amino acids MGQDQTKQQIEKGLQLYQSNQTEKALQVWTKVLEKSSDLMGRFRVLGCLV

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAPSN Blocking Peptide, (ABIN5615759), is also available for use as a blocking control in assays to test for specificity of this RAPSN antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAPSN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAPSN

Target: RAPSN (Receptor-Associated Protein of The Synapse (RAPSN))

Alternative Name: RAPSN

Background: RAPSN belongs to a family of proteins that are receptor associated proteins of the synapse. It contains a conserved cAMP-dependent protein kinase phosphorylation site. It is believed to play some role in anchoring or stabilizing the nicotinic acetylcholine receptor at synaptic sites. It may link the receptor to the underlying postsynaptic cytoskeleton, possibly by direct association with actin or spectrin.

Molecular Weight: 39 kDa (MW of target protein)