TJP2 antibody

Catalog No. ABIN631228

This Rabbit Polyclonal antibody specifically detects TJP2 in WB. It exhibits reactivity toward Human and Dog.

Quick Overview for TJP2 antibody (ABIN631228)

Target: TJP2 (Tight Junction Protein 2 (Zona Occludens 2) (TJP2))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TJP2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TJP2 Antibody

Purification: Affinity purified

Immunogen: TJP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TVVPETNKEPRYQEDPPAPQPKAAPRTFLRPSPEDEAIYGPNTKMVRFKK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TJP2 Blocking Peptide, (ABIN5616618), is also available for use as a blocking control in assays to test for specificity of this TJP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TJP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TJP2

Target: TJP2 (Tight Junction Protein 2 (Zona Occludens 2) (TJP2))

Alternative Name: TJP2

Background: Tight junction proteins (TJPs) belong to a family of membrane-associated guanylate kinase (MAGUK) homologs that are involved in the organization of epithelial and endothelial intercellular junctions. TJPs bind to the cytoplasmic C termini of junctional transmembrane proteins and link them to the actin cytoskeleton.

Molecular Weight: 134 kDa (MW of target protein)