PTP4A3 antibody (Middle Region)

Catalog No. ABIN631230

The Rabbit Polyclonal anti-PTP4A3 antibody (ABIN631230) specifically detects PTP4A3 in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for PTP4A3 antibody (Middle Region) (ABIN631230)

Target: PTP4A3 (Protein Tyrosine Phosphatase Type IVA, Member 3 (PTP4A3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PTP4A3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PTP4A3 Antibody

Binding Specificity: Middle Region

Specificity: PTP4 A3 antibody was raised against the middle region of PTP4 3

Purification: Affinity purified

Immunogen: PTP4 A3 antibody was raised using the middle region of PTP4 3 corresponding to a region with amino acids LGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PTP4A3 Blocking Peptide, (ABIN940379), is also available for use as a blocking control in assays to test for specificity of this PTP4A3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTP0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PTP4A3

Target: PTP4A3 (Protein Tyrosine Phosphatase Type IVA, Member 3 (PTP4A3))

Alternative Name: PTP4A3

Background: PTP4A3 belongs to a small class of prenylated protein tyrosine phosphatases (PTPs). PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. This class of PTPs contains a PTP domain and a characteristic C-terminal prenylation motif. Studies of this class of PTPs in mice demonstrated that they were prenylated proteins in vivo, which suggested their association with cell plasma membrane. Overexpression of this gene in mammalian cells was reported to inhibit angiotensin-II induced cell calcium mobilization and promote cell growth.

Molecular Weight: 19 kDa (MW of target protein)