ATP6V1B2 antibody (Middle Region)
-
- Target See all ATP6V1B2 Antibodies
- ATP6V1B2 (ATPase, H+ Transporting, Lysosomal 56/58kDa, V1 Subunit B2 (ATP6V1B2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ATP6V1B2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ATP6 V6 2 antibody was raised against the middle region of ATP6 6 2
- Purification
- Affinity purified
- Immunogen
- ATP6 V6 2 antibody was raised using the middle region of ATP6 6 2 corresponding to a region with amino acids NFIAQGPYENRTVFETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAK
- Top Product
- Discover our top product ATP6V1B2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ATP6V1B2 Blocking Peptide, catalog no. 33R-6683, is also available for use as a blocking control in assays to test for specificity of this ATP6V1B2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATP6V1B2 (ATPase, H+ Transporting, Lysosomal 56/58kDa, V1 Subunit B2 (ATP6V1B2))
- Alternative Name
- ATP6V1B2 (ATP6V1B2 Products)
- Background
- ATP6V1B2 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. ATP6V1B2 is one of two V1 domain B subunit isoforms and is the only B isoform highly expressed in osteoclasts.
- Molecular Weight
- 56 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis, Proton Transport
-