ATP6V1B2 antibody (Middle Region)

Catalog No. ABIN631234

This Rabbit Polyclonal antibody specifically detects ATP6V1B2 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for ATP6V1B2 antibody (Middle Region) (ABIN631234)

Target: ATP6V1B2 (ATPase, H+ Transporting, Lysosomal 56/58kDa, V1 Subunit B2 (ATP6V1B2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATP6V1B2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ATP6V1B2 Antibody

Binding Specificity: Middle Region

Specificity: ATP6 V6 2 antibody was raised against the middle region of ATP6 6 2

Purification: Affinity purified

Immunogen: ATP6 V6 2 antibody was raised using the middle region of ATP6 6 2 corresponding to a region with amino acids NFIAQGPYENRTVFETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ATP6V1B2 Blocking Peptide, (ABIN5612235), is also available for use as a blocking control in assays to test for specificity of this ATP6V1B2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATP6V1B2

Target: ATP6V1B2 (ATPase, H+ Transporting, Lysosomal 56/58kDa, V1 Subunit B2 (ATP6V1B2))

Alternative Name: ATP6V1B2

Background: ATP6V1B2 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. ATP6V1B2 is one of two V1 domain B subunit isoforms and is the only B isoform highly expressed in osteoclasts.

Molecular Weight: 56 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Proton Transport