FERMT1 antibody

Catalog No. ABIN631240

Product Details anti-FERMT1 Antibody

Target: FERMT1 (Fermitin Family Member 1 (FERMT1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FERMT1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: FERMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSSTDFTFASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLKLVEQIN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FERMT1 Blocking Peptide, catalog no. 33R-5456, is also available for use as a blocking control in assays to test for specificity of this FERMT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FERMT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FERMT1

Target: FERMT1 (Fermitin Family Member 1 (FERMT1))

Alternative Name: FERMT1 (FERMT1 Products)

Synonyms: C20orf42 antibody, DTGCU2 antibody, KIND1 antibody, UNC112A antibody, URP1 antibody, 5830467P10Rik antibody, Kindlin-1 antibody, RGD1306816 antibody, si:ch73-22c10.1 antibody, wu:fc32b07 antibody, fermitin family member 1 antibody, fermitin family member 1 S homeolog antibody, fermitin family homolog 1 antibody, FERMT1 antibody, Fermt1 antibody, fermt1.S antibody, fermt1 antibody, LOC100548276 antibody

Background: FERMT1 is involved in cell adhesion, possibly via its interaction with integrins. It may mediate TGF-beta 1 signaling in tumor progression. Defects in FERMT1 are the cause of Kindler syndrome.

Molecular Weight: 77 kDa (MW of target protein)