MAK antibody (C-Term)

Catalog No. ABIN631245

This anti-MAK antibody is a Rabbit Polyclonal antibody detecting MAK in WB. Suitable for Human, Rat and Mouse.

Quick Overview for MAK antibody (C-Term) (ABIN631245)

Target: MAK (Male Germ Cell-Associated Kinase (MAK))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAK antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MAK Antibody

Binding Specificity: C-Term

Specificity: MAK antibody was raised against the C terminal of MAK

Purification: Affinity purified

Immunogen: MAK antibody was raised using the C terminal of MAK corresponding to a region with amino acids WNTKTGRGQFSGRTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAK Blocking Peptide, (ABIN5614640), is also available for use as a blocking control in assays to test for specificity of this MAK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAK

Target: MAK (Male Germ Cell-Associated Kinase (MAK))

Alternative Name: MAK

Background: MAK is a serine/threonine protein kinase related to kinases involved in cell cycle regulation. It is expressed almost exclusively in the testis, primarily in germ cells. Studies of the mouse and rat homologs have localized the kinase to the chromosomes during meiosis in spermatogenesis, specifically to the synaptonemal complex that exists while homologous chromosomes are paired. There is, however, a study of the mouse homolog that has identified high levels of expression in developing sensory epithelia so its function may be more generalized.

Molecular Weight: 70 kDa (MW of target protein)