Ketohexokinase antibody

Catalog No. ABIN631256

Product Details anti-Ketohexokinase Antibody

Target: Ketohexokinase (KHK)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Ketohexokinase antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: KHK antibody was raised using a synthetic peptide corresponding to a region with amino acids FLVADFRRRGVDVSQVAWQSKGDTPSSCCIINNSNGNRTIVLHDTSLPDV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KHK Blocking Peptide, catalog no. 33R-2992, is also available for use as a blocking control in assays to test for specificity of this KHK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KHK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Ketohexokinase

Target: Ketohexokinase (KHK)

Alternative Name: KHK (KHK Products)

Synonyms: wu:fj68h03 antibody, zgc:92219 antibody, zgc:92626 antibody, KHK antibody, khk antibody, KETHPRO antibody, ketohexokinase antibody, Ketohexokinase antibody, KHK antibody, khk antibody, Hhal_0921 antibody, AaeL_AAEL006316 antibody, Nwat_0240 antibody, Khk antibody

Background: KHK is a ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The product of this gene is the first enzyme with a specialized pathway that catabolizes dietary fructose.

Molecular Weight: 32 kDa (MW of target protein)