CSNK2A1/CK II alpha antibody (Middle Region)

Catalog No. ABIN631269

This anti-CSNK2A1/CK II alpha antibody is a Rabbit Polyclonal antibody detecting CSNK2A1/CK II alpha in WB. Suitable for Human, Mouse, Rat, Drosophila melanogaster and C. elegans.

Quick Overview for CSNK2A1/CK II alpha antibody (Middle Region) (ABIN631269)

Target: CSNK2A1/CK II alpha (CSNK2A1) (Casein Kinase 2 alpha 1 (CSNK2A1))

Reactivity: Human, Mouse, Rat, Drosophila melanogaster, C. elegans

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CSNK2A1/CK II alpha antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CSNK2A1/CK II alpha Antibody

Binding Specificity: Middle Region

Specificity: CK2 alpha 1 antibody was raised against the middle region of CSNK2 A1

Purification: Affinity purified

Immunogen: CK2 alpha 1 antibody was raised using the middle region of CSNK2 A1 corresponding to a region with amino acids LGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CK2 alpha 1 Blocking Peptide, catalog no. 33R-4966, is also available for use as a blocking control in assays to test for specificity of this CK2 alpha 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CSNK2A1/CK II alpha

Target: CSNK2A1/CK II alpha (CSNK2A1) (Casein Kinase 2 alpha 1 (CSNK2A1))

Background: Casein kinase II is a serine/threonine protein kinase that phosphorylates acidic proteins such as casein. The kinase exists as a tetramer and is composed of an alpha, an alpha-prime, and two beta subunits. The alpha subunits contain the catalytic activity while the beta subunits undergo autophosphorylation. CSNK2A1 represents the alpha subunit.

Molecular Weight: 45 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome