RHPN1 antibody (Middle Region)

Catalog No. ABIN631270

This Rabbit Polyclonal antibody specifically detects RHPN1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for RHPN1 antibody (Middle Region) (ABIN631270)

Target: RHPN1 (Rhophilin, rho GTPase Binding Protein 1 (RHPN1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RHPN1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RHPN1 Antibody

Binding Specificity: Middle Region

Specificity: RHPN1 antibody was raised against the middle region of RHPN1

Purification: Affinity purified

Immunogen: RHPN1 antibody was raised using the middle region of RHPN1 corresponding to a region with amino acids SVLFNIGALHTQIGARQDRSCTEGARRAMEAFQRAAGAFSLLRENFSHAP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RHPN1 Blocking Peptide, (ABIN5615867), is also available for use as a blocking control in assays to test for specificity of this RHPN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHPN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RHPN1

Target: RHPN1 (Rhophilin, rho GTPase Binding Protein 1 (RHPN1))

Alternative Name: RHPN1

Background: RHPN1 has no enzymatic activity. RHPN1 may serve as a target for Rho, and interact with some cytoskeletal component upon Rho binding or relay a Rho signal to other molecules.

Molecular Weight: 73 kDa (MW of target protein)