RAD18 antibody

Catalog No. ABIN631295

The Rabbit Polyclonal anti-RAD18 antibody has been validated for WB. It is suitable to detect RAD18 in samples from Human.

Quick Overview for RAD18 antibody (ABIN631295)

Target: RAD18 (E3 ubiquitin-protein ligase RAD18 (RAD18))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAD18 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RAD18 Antibody

Purification: Affinity purified

Immunogen: RAD18 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAD18 Blocking Peptide, (ABIN5615730), is also available for use as a blocking control in assays to test for specificity of this RAD18 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAD18

Target: RAD18 (E3 ubiquitin-protein ligase RAD18 (RAD18))

Alternative Name: RAD18

Background: RAD18 is highly similar to S. cerevisiae DNA damage repair protein Rad18. Yeast Rad18 functions through its interaction with Rad6, which is an ubiquitin-conjugating enzyme required for post-replication repair of damaged DNA.

Molecular Weight: 56 kDa (MW of target protein)