KDM4B antibody (Middle Region)

Catalog No. ABIN631296

This anti-KDM4B antibody is a Rabbit Polyclonal antibody detecting KDM4B in WB. Suitable for Human.

Quick Overview for KDM4B antibody (Middle Region) (ABIN631296)

Target: KDM4B (Lysine (K)-Specific Demethylase 4B (KDM4B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KDM4B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KDM4B Antibody

Binding Specificity: Middle Region

Specificity: JMJD2 B antibody was raised against the middle region of JMJD2

Purification: Affinity purified

Immunogen: JMJD2 B antibody was raised using the middle region of JMJD2 corresponding to a region with amino acids DQDRKWFETWDEEVVGTFSNWGFEDDGTDKDTNFHVALENVDTTMKVHIK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

JMJD2B Blocking Peptide, (ABIN937510), is also available for use as a blocking control in assays to test for specificity of this JMJD2B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JMJD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KDM4B

Target: KDM4B (Lysine (K)-Specific Demethylase 4B (KDM4B))

Alternative Name: JMJD2B

Background: JMJD2 family proteins are classified into one group with JD2H and TUDOR domains and another group without JD2H or TUDOR domains. Because JMJD2C gene (also known as GASC1 gene) is amplified in esophageal squamous cell carcinoma (ESCC), JMJD2 family genes are cancer-associated genes.

Molecular Weight: 122 kDa (MW of target protein)

Pathways: Warburg Effect