EFHD2 antibody (N-Term)

Catalog No. ABIN631302

Product Details anti-EFHD2 Antibody

Target: EFHD2 (EF-Hand Domain Family, Member D2 (EFHD2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EFHD2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EFHD2 antibody was raised against the N terminal of EFHD2

Purification: Affinity purified

Immunogen: EFHD2 antibody was raised using the N terminal of EFHD2 corresponding to a region with amino acids MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EFHD2 Blocking Peptide, catalog no. 33R-6081, is also available for use as a blocking control in assays to test for specificity of this EFHD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFHD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EFHD2

Target: EFHD2 (EF-Hand Domain Family, Member D2 (EFHD2))

Alternative Name: EFHD2 (EFHD2 Products)

Background: EFHD2 may regulate B-cell receptor (BCR)-induced immature and primary B-cell apoptosis. It plays a role as negative regulator of the canonical NF-kappa-B-activating branch. EFHD2 controls spontaneous apoptosis through the regulation of BCL2L1 abundance.

Molecular Weight: 26 kDa (MW of target protein)