TRIM55 antibody (N-Term)

Catalog No. ABIN631327

This Rabbit Polyclonal antibody specifically detects TRIM55 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for TRIM55 antibody (N-Term) (ABIN631327)

Target: TRIM55 (Tripartite Motif Containing 55 (TRIM55))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRIM55 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TRIM55 Antibody

Binding Specificity: N-Term

Specificity: TRIM55 antibody was raised against the N terminal of TRIM55

Purification: Affinity purified

Immunogen: TRIM55 antibody was raised using the N terminal of TRIM55 corresponding to a region with amino acids SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRIM55 Blocking Peptide, (ABIN5616787), is also available for use as a blocking control in assays to test for specificity of this TRIM55 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM55 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRIM55

Target: TRIM55 (Tripartite Motif Containing 55 (TRIM55))

Alternative Name: TRIM55

Background: TRIM55 contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein associates transiently with microtubules, myosin, and titin during muscle sarcomere assembly. It may act as a transient adaptor and plays a regulatory role in the assembly of sarcomeres.

Molecular Weight: 60 kDa (MW of target protein)