HERC6 antibody (N-Term)

Catalog No. ABIN631343

The Rabbit Polyclonal anti-HERC6 antibody is suitable to detect HERC6 in samples from Human. It has been validated for WB.

Quick Overview for HERC6 antibody (N-Term) (ABIN631343)

Target: HERC6 (HECT and RLD Domain Containing E3 Ubiquitin Protein Ligase Family Member 6 (HERC6))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HERC6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HERC6 Antibody

Binding Specificity: N-Term

Specificity: HERC6 antibody was raised against the N terminal of HERC6

Purification: Affinity purified

Immunogen: HERC6 antibody was raised using the N terminal of HERC6 corresponding to a region with amino acids LSKDSQVFSWGKNSHGQLGLGKEFPSQASPQRVRSLEGIPLAQVAAGGAH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HERC6 Blocking Peptide, (ABIN5613991), is also available for use as a blocking control in assays to test for specificity of this HERC6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HERC6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HERC6

Target: HERC6 (HECT and RLD Domain Containing E3 Ubiquitin Protein Ligase Family Member 6 (HERC6))

Alternative Name: HERC6

Background: HERC6 belongs to the HERC family of ubiquitin ligases, all of which contain a HECT domain and at least 1 RCC1-like domain (RLD). The 350-amino acid HECT domain is predicted to catalyze the formation of a thioester with ubiquitin before transferring it to a substrate, and the RLD is predicted to act as a guanine nucleotide exchange factor for small G proteins.

Molecular Weight: 115 kDa (MW of target protein)