TRIM72 antibody (N-Term)

Catalog No. ABIN631346

The Rabbit Polyclonal anti-TRIM72 antibody has been validated for WB. It is suitable to detect TRIM72 in samples from Human and Rat.

Quick Overview for TRIM72 antibody (N-Term) (ABIN631346)

Target: TRIM72 (Tripartite Motif Containing 72 (TRIM72))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRIM72 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TRIM72 Antibody

Binding Specificity: N-Term

Specificity: TRIM72 antibody was raised against the N terminal of TRIM72

Purification: Affinity purified

Immunogen: TRIM72 antibody was raised using the N terminal of TRIM72 corresponding to a region with amino acids CASLGSHRGHRLLPAAEAHARLKTQLPQQKLQLQEACMRKEKSVAVLEHQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRIM72 Blocking Peptide, (ABIN937032), is also available for use as a blocking control in assays to test for specificity of this TRIM72 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM72 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRIM72

Target: TRIM72 (Tripartite Motif Containing 72 (TRIM72))

Alternative Name: TRIM72

Background: TRIM72 belongs to the TRIM/RBCC family. It contains 1 B box-type zinc finger and 1 B30.2/SPRY domain and 1 RING-type zinc finger. The function of TRIM72 remains unknown.

Molecular Weight: 53 kDa (MW of target protein)