RNF115 antibody (C-Term)

Catalog No. ABIN631370

The Rabbit Polyclonal anti-RNF115 antibody has been validated for WB. It is suitable to detect RNF115 in samples from Human and Mouse.

Quick Overview for RNF115 antibody (C-Term) (ABIN631370)

Target: RNF115 (Ring Finger Protein 115 (RNF115))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNF115 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RNF115 Antibody

Binding Specificity: C-Term

Specificity: ZNF364 antibody was raised against the C terminal Of Znf364

Purification: Affinity purified

Immunogen: ZNF364 antibody was raised using the C terminal Of Znf364 corresponding to a region with amino acids PWLELHDTCPVCRKSLNGEDSTRQSQSTEASASNRFSNDSQLHDRWTF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZNF364 Blocking Peptide, (ABIN5617165), is also available for use as a blocking control in assays to test for specificity of this ZNF364 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZNF364 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNF115

Target: RNF115 (Ring Finger Protein 115 (RNF115))

Alternative Name: ZNF364

Background: ZNF364 contains 1 RING-type zinc finger. The exact function of ZNF364 remains unknown.

Molecular Weight: 34 kDa (MW of target protein)