UBE2S antibody (N-Term)

Catalog No. ABIN631371

This anti-UBE2S antibody is a Rabbit Polyclonal antibody detecting UBE2S in WB. Suitable for Human, Rat and Mouse.

Quick Overview for UBE2S antibody (N-Term) (ABIN631371)

Target: UBE2S (Ubiquitin-Conjugating Enzyme E2S (UBE2S))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBE2S antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-UBE2S Antibody

Binding Specificity: N-Term

Specificity: UBE2 S antibody was raised against the N terminal of UBE2

Purification: Affinity purified

Immunogen: UBE2 S antibody was raised using the N terminal of UBE2 corresponding to a region with amino acids NSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBE2S Blocking Peptide, (ABIN5616877), is also available for use as a blocking control in assays to test for specificity of this UBE2S antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBE2S

Target: UBE2S (Ubiquitin-Conjugating Enzyme E2S (UBE2S))

Alternative Name: UBE2S

Background: UBE2S is a member of the ubiquitin-conjugating enzyme family. It is able to form a thiol ester linkage with ubiquitin in a ubiquitin activating enzyme-dependent manner, a characteristic property of ubiquitin carrier proteins.

Molecular Weight: 24 kDa (MW of target protein)

Pathways: Ubiquitin Proteasome Pathway