RC3H2 antibody (Middle Region)

Catalog No. ABIN631375

This Rabbit Polyclonal antibody specifically detects RC3H2 in WB. It exhibits reactivity toward Human.

Quick Overview for RC3H2 antibody (Middle Region) (ABIN631375)

Target: RC3H2 (Membrane Associated DNA Binding Protein (RC3H2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RC3H2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RC3H2 Antibody

Binding Specificity: Middle Region

Specificity: RC3 H2 antibody was raised against the middle region of RC3 2

Purification: Affinity purified

Immunogen: RC3 H2 antibody was raised using the middle region of RC3 2 corresponding to a region with amino acids YSRKGHETPQPQPNSKYKTSMCRDLRQQGGCPRGTNCTFAHSQEELEKYR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RC3H2 Blocking Peptide, (ABIN936224), is also available for use as a blocking control in assays to test for specificity of this RC3H2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RC0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RC3H2

Target: RC3H2 (Membrane Associated DNA Binding Protein (RC3H2))

Alternative Name: RC3H2

Background: The function of RC3H2 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 118 kDa (MW of target protein)