RSPRY1 antibody (N-Term)

Catalog No. ABIN631386

This anti-RSPRY1 antibody is a Rabbit Polyclonal antibody detecting RSPRY1 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for RSPRY1 antibody (N-Term) (ABIN631386)

Target: RSPRY1 (Ring Finger and SPRY Domain Containing 1 (RSPRY1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RSPRY1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RSPRY1 Antibody

Binding Specificity: N-Term

Specificity: RSPRY1 antibody was raised against the N terminal of RSPRY1

Purification: Affinity purified

Immunogen: RSPRY1 antibody was raised using the N terminal of RSPRY1 corresponding to a region with amino acids RSQPRDPVRPPRRGRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQEPPY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RSPRY1 Blocking Peptide, (ABIN5615968), is also available for use as a blocking control in assays to test for specificity of this RSPRY1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSPRY1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RSPRY1

Target: RSPRY1 (Ring Finger and SPRY Domain Containing 1 (RSPRY1))

Alternative Name: RSPRY1

Background: RSPRY1 contains 1 B30.2/SPRY domain and 1 RING-type zinc finger. The exact function of RSPRY1 remains unknown.

Molecular Weight: 64 kDa (MW of target protein)