RNF169 antibody (N-Term)

Catalog No. ABIN631397

The Rabbit Polyclonal anti-RNF169 antibody has been validated for WB. It is suitable to detect RNF169 in samples from Human and Rat.

Quick Overview for RNF169 antibody (N-Term) (ABIN631397)

Target: RNF169 (Ring Finger Protein 169 (RNF169))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNF169 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RNF169 Antibody

Binding Specificity: N-Term

Specificity: RNF169 antibody was raised against the N terminal of RNF169

Purification: Affinity purified

Immunogen: RNF169 antibody was raised using the N terminal of RNF169 corresponding to a region with amino acids DTETGKRKMDEQKKRDEPLVLKTNLERCPARLSDSENEEPSRGQMTQTHR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNF169 Blocking Peptide, (ABIN937578), is also available for use as a blocking control in assays to test for specificity of this RNF169 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF169 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNF169

Target: RNF169 (Ring Finger Protein 169 (RNF169))

Alternative Name: RNF169

Background: The function of RNF169 has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 77 kDa (MW of target protein)