KLHL15 antibody

Catalog No. ABIN631407

This anti-KLHL15 antibody is a Rabbit Polyclonal antibody detecting KLHL15 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for KLHL15 antibody (ABIN631407)

Target: KLHL15 (Kelch-Like 15 (KLHL15))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KLHL15 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KLHL15 Antibody

Purification: Affinity purified

Immunogen: KLHL15 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLDKQIMVLGGLCYNGHYSDSILTFDPDENKWKEDEYPRMPCKLDGLQVC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KLHL15 Blocking Peptide, (ABIN5614377), is also available for use as a blocking control in assays to test for specificity of this KLHL15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KLHL15

Target: KLHL15 (Kelch-Like 15 (KLHL15))

Alternative Name: KLHL15

Background: KLHL15 is a member of the kelch-like family of proteins that share a common domain structure consisting of an N-terminal broad-complex, tramtrack, bric-a-brac/poxvirus and zinc finger domain and C-terminal kelch repeat motifs. KLHL15 may be involved in protein ubiquitination and cytoskeletal organization.

Molecular Weight: 66 kDa (MW of target protein)