alpha Actinin 4 antibody (C-Term)

Catalog No. ABIN631408

Product Details anti-alpha Actinin 4 Antibody

Target: alpha Actinin 4 (ACTN4) (Actinin, alpha 4 (ACTN4))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This alpha Actinin 4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Alpha Actinin 4 antibody was raised against the C terminal of ACTN4

Purification: Affinity purified

Immunogen: alpha Actinin 4 antibody was raised using the C terminal of ACTN4 corresponding to a region with amino acids DVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVI

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Alpha Actinin 4 Blocking Peptide, catalog no. 33R-2213, is also available for use as a blocking control in assays to test for specificity of this Alpha Actinin 4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTN4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for alpha Actinin 4

Target: alpha Actinin 4 (ACTN4) (Actinin, alpha 4 (ACTN4))

Alternative Name: alpha Actinin 4 (ACTN4 Products)

Synonyms: fsgs antibody, fsgs1 antibody, C77391 antibody, ACTININ-4 antibody, FSGS antibody, FSGS1 antibody, wu:fb53f05 antibody, zgc:63508 antibody, actinin alpha 4 antibody, actinin, alpha 4 antibody, actinin alpha 4 S homeolog antibody, actn4 antibody, ACTN4 antibody, Actn4 antibody, actn4.S antibody

Background: Alpha actinins belong to the spectrin superfamily which is a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. ACTN4 is a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Mutations in its gene have been associated with focal and segmental glomerulosclerosis.

Molecular Weight: 105 kDa (MW of target protein)

Pathways: Proton Transport