CHN2 antibody
-
- Target See all CHN2 Antibodies
- CHN2 (Chimerin (Chimaerin) 2 (CHN2))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CHN2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- CHN2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AFGVKVGVKGGFLWPPLKLFACSQISSLVRRAALTHNDNHFNYEKTHNFK
- Top Product
- Discover our top product CHN2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CHN2 Blocking Peptide, catalog no. 33R-1162, is also available for use as a blocking control in assays to test for specificity of this CHN2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHN2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHN2 (Chimerin (Chimaerin) 2 (CHN2))
- Alternative Name
- CHN2 (CHN2 Products)
- Synonyms
- 1700026N20Rik antibody, 4930557O16Rik antibody, ARHGAP3 antibody, Bch antibody, BCH antibody, CHN2-3 antibody, RHOGAP3 antibody, chimerin 2 antibody, chimerin 2 L homeolog antibody, chn2 antibody, CHN2 antibody, Chn2 antibody, chn2.L antibody
- Background
- CHN2 is a protein with a phorbol-ester/DAG-type zinc finger, a Rho-GAP domain and an SH2 domain. This protein has GTPase-activating protein activity that is regulated by phospholipid binding and binding of diacylglycerol (DAG) induces translocation of the protein from the cytosol to the Golgi apparatus membrane. CHN2 plays a role in the proliferation and migration of smooth muscle cells. Decreased expression of this gene is associated with high-grade gliomas and breast tumors, and increased expression of this gene is associated with lymphomas. Mutations in this gene have been associated with schizophrenia in men.
- Molecular Weight
- 38 kDa (MW of target protein)
-