Copine IV antibody (N-Term)
Quick Overview for Copine IV antibody (N-Term) (ABIN631417)
Target
See all Copine IV (CPNE4) AntibodiesReactivity
Host
Clonality
Conjugate
Application
-
-
Binding Specificity
- N-Term
-
Specificity
- Copine IV antibody was raised against the N terminal of CPNE4
-
Purification
- Affinity purified
-
Immunogen
- Copine IV antibody was raised using the N terminal of CPNE4 corresponding to a region with amino acids EADFLGGMECTLGQIVSQRKLSKSLLKHGNTAGKSSITVIAEELSGNDDY
-
-
-
-
Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Comment
-
Copine IV Blocking Peptide, (ABIN937638), is also available for use as a blocking control in assays to test for specificity of this Copine IV antibody
-
Restrictions
- For Research Use only
-
-
-
Format
- Lyophilized
-
Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPNE4 antibody in PBS
-
Concentration
- Lot specific
-
Buffer
- PBS
-
Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Storage
- 4 °C/-20 °C
-
Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- Copine IV (CPNE4)
-
Alternative Name
- Copine IV
-
Background
- Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encode a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm.
-
Molecular Weight
- 62 kDa (MW of target protein)
Target
-