TNKS antibody (Middle Region)

Catalog No. ABIN631422

The Rabbit Polyclonal anti-TNKS antibody (ABIN631422) specifically detects TNKS in WB. The antibody is reactive with Human and Mouse samples.

Quick Overview for TNKS antibody (Middle Region) (ABIN631422)

Target: TNKS (Tankyrase, TRF1-Interacting Ankyrin-Related ADP-Ribose Polymerase (TNKS))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TNKS antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TNKS Antibody

Binding Specificity: Middle Region

Specificity: TNKS antibody was raised against the middle region of TNKS

Purification: Affinity purified

Immunogen: TNKS antibody was raised using the middle region of TNKS corresponding to a region with amino acids LIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQST

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TNKS Blocking Peptide, (ABIN940434), is also available for use as a blocking control in assays to test for specificity of this TNKS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNKS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TNKS

Target: TNKS (Tankyrase, TRF1-Interacting Ankyrin-Related ADP-Ribose Polymerase (TNKS))

Alternative Name: TNKS

Background: TNKS may regulate vesicle trafficking and modulate the subcellular distribution of SLC2A4/GLUT4-vesicles. It has PARP activity and can modify TERF1, and thereby contribute to the regulation of telomere length.

Molecular Weight: 142 kDa (MW of target protein)