Pallidin antibody

Catalog No. ABIN631430

The Rabbit Polyclonal anti-Pallidin antibody is suitable to detect Pallidin in samples from Human and Mouse. It has been validated for WB.

Quick Overview for Pallidin antibody (ABIN631430)

Target: Pallidin (PLDN) (Pallidin Homolog (PLDN))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Pallidin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Pallidin Antibody

Purification: Affinity purified

Immunogen: PLDN antibody was raised using a synthetic peptide corresponding to a region with amino acids MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PLDN Blocking Peptide, (ABIN5615411), is also available for use as a blocking control in assays to test for specificity of this PLDN antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLDN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Pallidin

Target: Pallidin (PLDN) (Pallidin Homolog (PLDN))

Alternative Name: PLDN

Background: PLDN may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion.

Molecular Weight: 20 kDa (MW of target protein)

Pathways: Synaptic Vesicle Exocytosis