BAAT antibody (N-Term)

Catalog No. ABIN631444

This Rabbit Polyclonal antibody specifically detects BAAT in WB. It exhibits reactivity toward Human.

Quick Overview for BAAT antibody (N-Term) (ABIN631444)

Target: BAAT (Bile Acid CoA: Amino Acid N-Acyltransferase (Glycine N-Choloyltransferase) (BAAT))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BAAT antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-BAAT Antibody

Binding Specificity: N-Term

Specificity: BAAT antibody was raised against the N terminal of BAAT

Purification: Affinity purified

Immunogen: BAAT antibody was raised using the N terminal of BAAT corresponding to a region with amino acids IQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHYR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BAAT Blocking Peptide, (ABIN939504), is also available for use as a blocking control in assays to test for specificity of this BAAT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BAAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BAAT

Target: BAAT (Bile Acid CoA: Amino Acid N-Acyltransferase (Glycine N-Choloyltransferase) (BAAT))

Alternative Name: BAAT

Background: BAAT is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA).

Molecular Weight: 46 kDa (MW of target protein)