BLMH antibody (Middle Region)

Catalog No. ABIN631453

This Rabbit Polyclonal antibody specifically detects BLMH in WB. It exhibits reactivity toward Human, Rat and Mouse.

Quick Overview for BLMH antibody (Middle Region) (ABIN631453)

Target: BLMH (Bleomycin Hydrolase (BLMH))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BLMH antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-BLMH Antibody

Binding Specificity: Middle Region

Specificity: BLMH antibody was raised against the middle region of BLMH

Purification: Affinity purified

Immunogen: BLMH antibody was raised using the middle region of BLMH corresponding to a region with amino acids EYLSNMVGGRKTLYNNQPIDFLKKMVAASIKDGEAVWFGCDVGKHFNSKL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BLMH Blocking Peptide, (ABIN938211), is also available for use as a blocking control in assays to test for specificity of this BLMH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BLMH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BLMH

Target: BLMH (Bleomycin Hydrolase (BLMH))

Alternative Name: BLMH

Background: The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B-aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity.

Molecular Weight: 52 kDa (MW of target protein)