KDM4B antibody (Middle Region)
-
- Target See all KDM4B Antibodies
- KDM4B (Lysine (K)-Specific Demethylase 4B (KDM4B))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KDM4B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- JMJD2 B antibody was raised against the middle region of JMJD2
- Purification
- Affinity purified
- Immunogen
- JMJD2 B antibody was raised using the middle region of JMJD2 corresponding to a region with amino acids SASRASLKAKLLRRSHRKRSQPKKPKPEDPKFPGEGTAGAALLEEAGGSV
- Top Product
- Discover our top product KDM4B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
JMJD2B Blocking Peptide, catalog no. 33R-8316, is also available for use as a blocking control in assays to test for specificity of this JMJD2B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JMJD0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KDM4B (Lysine (K)-Specific Demethylase 4B (KDM4B))
- Alternative Name
- JMJD2B (KDM4B Products)
- Background
- JMJD2 family proteins are classified into one group with JD2H and TUDOR domains and another group without JD2H or TUDOR domains. Because JMJD2C gene (also known as GASC1 gene) is amplified in esophageal squamous cell carcinoma (ESCC), JMJD2 family genes are cancer-associated genes.
- Molecular Weight
- 122 kDa (MW of target protein)
- Pathways
- Warburg Effect
-