CDCA5 antibody (Middle Region)

Catalog No. ABIN631455

The Rabbit Polyclonal anti-CDCA5 antibody (ABIN631455) specifically detects CDCA5 in WB. The antibody is reactive with Human samples.

Quick Overview for CDCA5 antibody (Middle Region) (ABIN631455)

Target: CDCA5 (Cell Division Cycle Associated 5 (CDCA5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CDCA5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CDCA5 Antibody

Binding Specificity: Middle Region

Specificity: CDCA5 antibody was raised against the middle region of CDCA5

Purification: Affinity purified

Immunogen: CDCA5 antibody was raised using the middle region of CDCA5 corresponding to a region with amino acids RRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CDCA5 Blocking Peptide, (ABIN5612778), is also available for use as a blocking control in assays to test for specificity of this CDCA5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDCA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CDCA5

Target: CDCA5 (Cell Division Cycle Associated 5 (CDCA5))

Alternative Name: CDCA5

Background: CDCA5 is the regulator of sister chromatid cohesion in mitosis. It may act by regulating the ability of the cohesin complex to mediate sister chromatid cohesion, perhaps by altering the nature of the interaction of cohesin with the chromosomes.

Molecular Weight: 28 kDa (MW of target protein)

Pathways: Chromatin Binding