ALOX15B antibody (N-Term)

Catalog No. ABIN631457

The Rabbit Polyclonal anti-ALOX15B antibody has been validated for WB. It is suitable to detect ALOX15B in samples from Human.

Quick Overview for ALOX15B antibody (N-Term) (ABIN631457)

Target: ALOX15B (Arachidonate 15-Lipoxygenase B (ALOX15B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALOX15B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ALOX15B Antibody

Binding Specificity: N-Term

Specificity: ALOX15 B antibody was raised against the N terminal of ALOX15

Purification: Affinity purified

Immunogen: ALOX15 B antibody was raised using the N terminal of ALOX15 corresponding to a region with amino acids MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALOX15B Blocking Peptide, (ABIN5612030), is also available for use as a blocking control in assays to test for specificity of this ALOX15B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALOX10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALOX15B

Target: ALOX15B (Arachidonate 15-Lipoxygenase B (ALOX15B))

Alternative Name: ALOX15B

Background: ALOX15B is a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while metabolizing linoleic acid less effectively.

Molecular Weight: 67 kDa (MW of target protein)