MYH10 antibody (N-Term)

Catalog No. ABIN631458

This anti-MYH10 antibody is a Rabbit Polyclonal antibody detecting MYH10 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for MYH10 antibody (N-Term) (ABIN631458)

Target: MYH10 (Myosin, Heavy Polypeptide 10, Non-Muscle (MYH10))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MYH10 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MYH10 Antibody

Binding Specificity: N-Term

Specificity: MYH10 antibody was raised against the N terminal of MYH10

Purification: Affinity purified

Immunogen: MYH10 antibody was raised using the N terminal of MYH10 corresponding to a region with amino acids WFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKAD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MYH10 Blocking Peptide, (ABIN5614894), is also available for use as a blocking control in assays to test for specificity of this MYH10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYH10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MYH10

Target: MYH10 (Myosin, Heavy Polypeptide 10, Non-Muscle (MYH10))

Alternative Name: MYH10

Background: MYH10 is the cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping.

Molecular Weight: 229 kDa (MW of target protein)