CDC42EP4 antibody

Catalog No. ABIN631473

Product Details anti-CDC42EP4 Antibody

Target: CDC42EP4 (CDC42 Effector Protein (Rho GTPase Binding) 4 (CDC42EP4))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CDC42EP4 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: CDC42 EP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSSKRSLLSRKFRGSKRSQSVTRGEREQRDMLGSLRDSALFVKNAMSLPQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CDC42EP4 Blocking Peptide, catalog no. 33R-8850, is also available for use as a blocking control in assays to test for specificity of this CDC42EP4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC40 P4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CDC42EP4

Target: CDC42EP4 (CDC42 Effector Protein (Rho GTPase Binding) 4 (CDC42EP4))

Alternative Name: CDC42EP4 (CDC42EP4 Products)

Background: CDC42EP4 is a member of the CDC42-binding protein family. Members of this family interact with Rho family GTPases and regulate the organization of the actin cytoskeleton. The protein has been shown to bind both CDC42 and TC10 GTPases in a GTP-dependent manner. When overexpressed in fibroblasts, the protein was able to induce pseudopodia formation, which suggested a role in inducing actin filament assembly and cell shape control.

Molecular Weight: 38 kDa (MW of target protein)