LAP3 antibody (N-Term)

Catalog No. ABIN631475

The Rabbit Polyclonal anti-LAP3 antibody has been validated for WB. It is suitable to detect LAP3 in samples from Human, Mouse and Rat.

Quick Overview for LAP3 antibody (N-Term) (ABIN631475)

Target: LAP3 (Cytosol Aminopeptidase (LAP3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LAP3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LAP3 Antibody

Binding Specificity: N-Term

Specificity: LAP3 antibody was raised against the N terminal of LAP3

Purification: Affinity purified

Immunogen: LAP3 antibody was raised using the N terminal of LAP3 corresponding to a region with amino acids LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKEN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LAP3 Blocking Peptide, (ABIN5614413), is also available for use as a blocking control in assays to test for specificity of this LAP3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LAP3

Target: LAP3 (Cytosol Aminopeptidase (LAP3))

Alternative Name: LAP3

Background: LAP3 is presumably involved in the processing and regular turnover of intracellular proteins. LAP3 catalyzes the removal of unsubstituted N-terminal amino acids from various peptides.

Molecular Weight: 56 kDa (MW of target protein)