TUBA4A antibody (Middle Region)

Catalog No. ABIN631484

The Rabbit Polyclonal anti-TUBA4A antibody is suitable to detect TUBA4A in samples from Human, Mouse, Rat, Drosophila melanogaster, Arabidopsis and C. elegans. It has been validated for WB.

Quick Overview for TUBA4A antibody (Middle Region) (ABIN631484)

Target: TUBA4A (Tubulin, alpha 4a (TUBA4A))

Reactivity: Human, Mouse, Rat, Drosophila melanogaster, Arabidopsis, C. elegans

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TUBA4A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TUBA4A Antibody

Binding Specificity: Middle Region

Specificity: Alpha Tubulin 4 A antibody was raised against the middle region of TUBA4

Purification: Affinity purified

Immunogen: alpha Tubulin 4 A antibody was raised using the middle region of TUBA4 corresponding to a region with amino acids GGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

alpha Tubulin 4A Blocking Peptide, (ABIN938687), is also available for use as a blocking control in assays to test for specificity of this alpha Tubulin 4A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TUBA4A

Target: TUBA4A (Tubulin, alpha 4a (TUBA4A))

Alternative Name: alpha Tubulin 4A

Background: Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily.

Molecular Weight: 50 kDa (MW of target protein)

Pathways: Microtubule Dynamics, M Phase