PAOX antibody
-
- Target See all PAOX Antibodies
- PAOX (Polyamine Oxidase (Exo-N4-Amino) (PAOX))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PAOX antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PAOX antibody was raised using a synthetic peptide corresponding to a region with amino acids LCLTQVLRRVTGNPRLPAPKSVLRSRWHSAPYTRGSYSYVAVGSTGGDLD
- Top Product
- Discover our top product PAOX Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PAOX Blocking Peptide, catalog no. 33R-4825, is also available for use as a blocking control in assays to test for specificity of this PAOX antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAOX antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PAOX (Polyamine Oxidase (Exo-N4-Amino) (PAOX))
- Alternative Name
- PAOX (PAOX Products)
- Synonyms
- PAO antibody, mpao1 antibody, 2410012F02Rik antibody, AI118225 antibody, Pao antibody, pao antibody, polyamine oxidase antibody, polyamine oxidase 1 antibody, amine oxidase family protein antibody, si:dkey-275b16.2 antibody, polyamine oxidase (exo-N4-amino) antibody, polyamine oxidase (exo-N4-amino) L homeolog antibody, PAOX antibody, pao1 antibody, NFIA_077590 antibody, POPTR_0011s12590g antibody, si:dkey-275b16.2 antibody, Paox antibody, paox.L antibody
- Background
- PAOX belongs to the flavin monoamine oxidase family. PAOX is a flavoenzyme which catalyzes the oxidation of N(1)-acetylspermine to spermidine and is thus involved in the polyamine back-conversion. It can also oxidize N(1)-acetylspermidine to putrescine. PAOX does not oxidize spermidine. It plays an important role in the regulation of polyamine intracellular concentration and has the potential to act as a determinant of cellular sensitivity to the antitumor polyamine analogs.
- Molecular Weight
- 25 kDa (MW of target protein)
-