KRT23 antibody
-
- Target See all KRT23 Antibodies
- KRT23 (Keratin 23 (KRT23))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KRT23 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Cytokeratin 23 antibody was raised using a synthetic peptide corresponding to a region with amino acids IKTHLEKEITTYRRLLEGESEGTREESKSSMKVSATPKIKAITQETINGR
- Top Product
- Discover our top product KRT23 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Cytokeratin 23 Blocking Peptide, catalog no. 33R-4032, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 23 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT23 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KRT23 (Keratin 23 (KRT23))
- Alternative Name
- Cytokeratin 23 (KRT23 Products)
- Background
- KRT23 is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains.
- Molecular Weight
- 48 kDa (MW of target protein)
-