TCP10 antibody

Catalog No. ABIN631533

This anti-TCP10 antibody is a Rabbit Polyclonal antibody detecting TCP10 in WB. Suitable for Human.

Quick Overview for TCP10 antibody (ABIN631533)

Target: TCP10 (T-Complex 10 (TCP10))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TCP10 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TCP10 Antibody

Purification: Affinity purified

Immunogen: TCP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids ERINSGKTPPQEDREKSPPGRRQDRSPAPTGRPTPGAERRGVSEDGKIMH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TCP10 Blocking Peptide, (ABIN938083), is also available for use as a blocking control in assays to test for specificity of this TCP10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCP10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TCP10

Target: TCP10 (T-Complex 10 (TCP10))

Alternative Name: TCP10

Background: The function of TCP10 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 35 kDa (MW of target protein)