METTL6 antibody (N-Term)

Catalog No. ABIN631546

This Rabbit Polyclonal antibody specifically detects METTL6 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for METTL6 antibody (N-Term) (ABIN631546)

Target: METTL6 (Methyltransferase Like 6 (METTL6))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This METTL6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-METTL6 Antibody

Binding Specificity: N-Term

Specificity: METTL6 antibody was raised against the N terminal of METTL6

Purification: Affinity purified

Immunogen: METTL6 antibody was raised using the N terminal of METTL6 corresponding to a region with amino acids QKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQKLTML

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

METTL6 Blocking Peptide, (ABIN5614732), is also available for use as a blocking control in assays to test for specificity of this METTL6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METTL6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for METTL6

Target: METTL6 (Methyltransferase Like 6 (METTL6))

Alternative Name: METTL6

Background: METTL6 is a probable methyltransferase.

Molecular Weight: 33 kDa (MW of target protein)