LOC652559 antibody (Middle Region)

Catalog No. ABIN631554

This anti-LOC652559 antibody is a Rabbit Polyclonal antibody detecting LOC652559 in WB. Suitable for Human.

Quick Overview for LOC652559 antibody (Middle Region) (ABIN631554)

Target: LOC652559

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LOC652559 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LOC652559 Antibody

Binding Specificity: Middle Region

Specificity: LOC652559 antibody was raised against the middle region of Loc652559

Purification: Affinity purified

Immunogen: LOC652559 antibody was raised using the middle region of Loc652559 corresponding to a region with amino acids EKSKLGEVDHTLDLVVSFIQEQIVTEEAKSKNSGDAGVDRSLRGPYLARL

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LOC652559 Blocking Peptide, (ABIN937908), is also available for use as a blocking control in assays to test for specificity of this LOC652559 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC652559 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LOC652559

Target: LOC652559

Alternative Name: LOC652559

Background: The sequence of LOC652559 is derived from an annotated genomic sequence (NW_922352) using gene prediction method: GNOMON. The exact function of LOC652559 remains unknown.

Molecular Weight: 32 kDa (MW of target protein)