LOC652618 antibody (N-Term)

Catalog No. ABIN631555

This Rabbit Polyclonal antibody specifically detects LOC652618 in WB. It exhibits reactivity toward Human.

Quick Overview for LOC652618 antibody (N-Term) (ABIN631555)

Target: LOC652618

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Application: Western Blotting (WB)

Product Details anti-LOC652618 Antibody

Binding Specificity: N-Term

Specificity: LOC652618 antibody was raised against the N terminal Of Loc652618

Purification: Affinity purified

Immunogen: LOC652618 antibody was raised using the N terminal Of Loc652618 corresponding to a region with amino acids MAGRSGHVDVVNERRLKPLYDNLDNGNYKMALQAADKLLKKHKDLHCAKV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LOC652618 Blocking Peptide, (ABIN5614531), is also available for use as a blocking control in assays to test for specificity of this LOC652618 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC652618 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LOC652618

Target: LOC652618

Alternative Name: LOC652618

Background: The function of LOC652618 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 14 kDa (MW of target protein)