GCLC antibody (N-Term)

Catalog No. ABIN631566

This anti-GCLC antibody is a Rabbit Polyclonal antibody detecting GCLC in WB. Suitable for Human, Mouse and Rat.

Quick Overview for GCLC antibody (N-Term) (ABIN631566)

Target: GCLC (Glutamate-Cysteine Ligase, Catalytic Subunit (GCLC))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GCLC antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GCLC Antibody

Binding Specificity: N-Term

Specificity: GCLC antibody was raised against the N terminal of GCLC

Purification: Affinity purified

Immunogen: GCLC antibody was raised using the N terminal of GCLC corresponding to a region with amino acids VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GCLC Blocking Peptide, (ABIN5613739), is also available for use as a blocking control in assays to test for specificity of this GCLC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCLC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GCLC

Target: GCLC (Glutamate-Cysteine Ligase, Catalytic Subunit (GCLC))

Alternative Name: GCLC

Background: Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. GCLC is the catalytic subunit of 637 amino acids with a calculated molecular weight of 72.773 kDa. Deficiency of gamma-glutamylcysteine synthetase in human is associated with enzymopathic hemolytic anemia.

Molecular Weight: 73 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis