GCLC antibody (N-Term)
-
- Target See all GCLC Antibodies
- GCLC (Glutamate-Cysteine Ligase, Catalytic Subunit (GCLC))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GCLC antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GCLC antibody was raised against the N terminal of GCLC
- Purification
- Affinity purified
- Immunogen
- GCLC antibody was raised using the N terminal of GCLC corresponding to a region with amino acids VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN
- Top Product
- Discover our top product GCLC Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GCLC Blocking Peptide, catalog no. 33R-9653, is also available for use as a blocking control in assays to test for specificity of this GCLC antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCLC antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GCLC (Glutamate-Cysteine Ligase, Catalytic Subunit (GCLC))
- Alternative Name
- GCLC (GCLC Products)
- Synonyms
- GCLC antibody, gclc antibody, MGC146287 antibody, 2259 antibody, CG2259 antibody, DmGCLC antibody, DmGCS antibody, DmGCSh antibody, Dmel\\CG2259 antibody, GCL antibody, GCLc antibody, GCSh antibody, Gcs antibody, Gcsh antibody, DDBDRAFT_0186120 antibody, DDBDRAFT_0231403 antibody, DDB_0186120 antibody, DDB_0231403 antibody, GCS antibody, GLCL antibody, GLCLC antibody, D9Wsu168e antibody, GLCL-H antibody, Ggcs-hs antibody, Glclc antibody, cb1049 antibody, fe36e11 antibody, wu:fe36e11 antibody, glutamate-cysteine ligase catalytic subunit antibody, glutamate-cysteine ligase, catalytic subunit antibody, Glutamate-cysteine ligase catalytic subunit antibody, gamma glutamylcysteine synthetase antibody, glutamate-cysteine ligase, catalytic subunit L homeolog antibody, glutamate-cysteine ligase, catalytic subunit S homeolog antibody, gamma-glutamylcysteine synthetase antibody, GCLC antibody, gclc antibody, Gclc antibody, LbGCS antibody, gcsA antibody, gclc.L antibody, gclc.S antibody, GSH1 antibody
- Background
- Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. GCLC is the catalytic subunit of 637 amino acids with a calculated molecular weight of 72.773 kDa. Deficiency of gamma-glutamylcysteine synthetase in human is associated with enzymopathic hemolytic anemia.
- Molecular Weight
- 73 kDa (MW of target protein)
- Pathways
- Cell RedoxHomeostasis
-