Keratin 84 antibody (Middle Region)
-
- Target See all Keratin 84 (KRT84) products
- Keratin 84 (KRT84)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Keratin 84 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Cytokeratin 84 antibody was raised against the middle region of KRT84
- Purification
- Affinity purified
- Immunogen
- Cytokeratin 84 antibody was raised using the middle region of KRT84 corresponding to a region with amino acids ESYITNLRRQLEVLVSDQARLQAERNHLQDVLEGFKKKYEEEVVCRANAE
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Cytokeratin 84 Blocking Peptide, catalog no. 33R-2754, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 84 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT84 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Keratin 84 (KRT84)
- Abstract
- KRT84 Products
- Synonyms
- Kb24 antibody, KRT84 antibody, KRTHB4 antibody, HB4 antibody, AV235125 antibody, HRb-1 antibody, Krt2-16 antibody, Krt2-3 antibody, keratin 84 antibody, Krt84 antibody, KRT84 antibody
- Background
- The protein encoded by this gene is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails.
- Molecular Weight
- 65 kDa (MW of target protein)
-