RPL37A antibody (Middle Region)

Catalog No. ABIN631577

The Rabbit Polyclonal anti-RPL37A antibody has been validated for WB. It is suitable to detect RPL37A in samples from Human, Mouse and Rat.

Quick Overview for RPL37A antibody (Middle Region) (ABIN631577)

Target: RPL37A (Ribosomal Protein L37a (RPL37A))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPL37A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RPL37A Antibody

Binding Specificity: Middle Region

Specificity: RPL37 A antibody was raised against the middle region of RPL37

Purification: Affinity purified

Immunogen: RPL37 A antibody was raised using the middle region of RPL37 corresponding to a region with amino acids CGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPL37A Blocking Peptide, (ABIN937089), is also available for use as a blocking control in assays to test for specificity of this RPL37A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPL37A

Target: RPL37A (Ribosomal Protein L37a (RPL37A))

Alternative Name: RPL37A

Background: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Molecular Weight: 10 kDa (MW of target protein)