RPS13 antibody (N-Term)

Catalog No. ABIN631578

This anti-RPS13 antibody is a Rabbit Polyclonal antibody detecting RPS13 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for RPS13 antibody (N-Term) (ABIN631578)

Target: RPS13 (Ribosomal Protein S13 (RPS13))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPS13 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RPS13 Antibody

Binding Specificity: N-Term

Specificity: RPS13 antibody was raised against the N terminal of RPS13

Purification: Affinity purified

Immunogen: RPS13 antibody was raised using the N terminal of RPS13 corresponding to a region with amino acids MGRMHAPGKGLSQSALPYRRSVPTWLKLTSDDVKEQIYKLAKKGLTPSQI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPS13 Blocking Peptide, (ABIN5615944), is also available for use as a blocking control in assays to test for specificity of this RPS13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPS13

Target: RPS13 (Ribosomal Protein S13 (RPS13))

Alternative Name: RPS13

Background: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Molecular Weight: 17 kDa (MW of target protein)