RPS15 antibody (Middle Region)

Catalog No. ABIN631579

This Rabbit Polyclonal antibody specifically detects RPS15 in WB. It exhibits reactivity toward Human, Mouse, Rat and C. elegans.

Quick Overview for RPS15 antibody (Middle Region) (ABIN631579)

Target: RPS15 (Ribosomal Protein S15 (RPS15))

Reactivity: Human, Mouse, Rat, C. elegans

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPS15 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RPS15 Antibody

Binding Specificity: Middle Region

Specificity: RPS15 antibody was raised against the middle region of RPS15

Purification: Affinity purified

Immunogen: RPS15 antibody was raised using the middle region of RPS15 corresponding to a region with amino acids GVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPS15 Blocking Peptide, (ABIN939048), is also available for use as a blocking control in assays to test for specificity of this RPS15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS15 antibody in PBS

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPS15

Target: RPS15 (Ribosomal Protein S15 (RPS15))

Alternative Name: RPS15

Background: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Molecular Weight: 17 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly