RPS15A antibody (Middle Region)

Catalog No. ABIN631582

This Rabbit Polyclonal antibody specifically detects RPS15A in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for RPS15A antibody (Middle Region) (ABIN631582)

Target: RPS15A (RA) (Ribosomal Protein S15a (RA))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPS15A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RPS15A Antibody

Binding Specificity: Middle Region

Specificity: RPS15 A antibody was raised against the middle region of RPS15

Purification: Affinity purified

Immunogen: RPS15 A antibody was raised using the middle region of RPS15 corresponding to a region with amino acids KCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPS15A Blocking Peptide, (ABIN939655), is also available for use as a blocking control in assays to test for specificity of this RPS15A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPS15A

Target: RPS15A (RA) (Ribosomal Protein S15a (RA))

Alternative Name: RPS15A

Background: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit.

Molecular Weight: 15 kDa (MW of target protein)