ATP6V1A antibody (N-Term)

Catalog No. ABIN631586

The Rabbit Polyclonal anti-ATP6V1A antibody has been validated for WB. It is suitable to detect ATP6V1A in samples from Human, Mouse and Rat.

Quick Overview for ATP6V1A antibody (N-Term) (ABIN631586)

Target: ATP6V1A (ATPase, H+ Transporting, Lysosomal 70kDa, V1 Subunit A (ATP6V1A))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATP6V1A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ATP6V1A Antibody

Binding Specificity: N-Term

Specificity: ATP6 V6 antibody was raised against the N terminal of ATP6 6

Purification: Affinity purified

Immunogen: ATP6 V6 antibody was raised using the N terminal of ATP6 6 corresponding to a region with amino acids SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ATP6V1A Blocking Peptide, (ABIN5612233), is also available for use as a blocking control in assays to test for specificity of this ATP6V1A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATP6V1A

Target: ATP6V1A (ATPase, H+ Transporting, Lysosomal 70kDa, V1 Subunit A (ATP6V1A))

Alternative Name: ATP6V1A

Background: This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles.

Molecular Weight: 68 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Proton Transport, SARS-CoV-2 Protein Interactome