RPL13A antibody (Middle Region)

Catalog No. ABIN631597

This Rabbit Polyclonal antibody specifically detects RPL13A in WB. It exhibits reactivity toward Human.

Quick Overview for RPL13A antibody (Middle Region) (ABIN631597)

Target: RPL13A (Ribosomal Protein L13a (RPL13A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPL13A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RPL13A Antibody

Binding Specificity: Middle Region

Specificity: RPL13 A antibody was raised against the middle region of RPL13

Purification: Affinity purified

Immunogen: RPL13 A antibody was raised using the middle region of RPL13 corresponding to a region with amino acids HEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPL13A Blocking Peptide, (ABIN939110), is also available for use as a blocking control in assays to test for specificity of this RPL13A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPL13A

Target: RPL13A (Ribosomal Protein L13a (RPL13A))

Alternative Name: RPL13A

Background: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Molecular Weight: 22 kDa (MW of target protein)